быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Proteinase 3/PR3 Rabbit mAb (A19748)
- Описание
- Характеристики
-
Overview
Product name Proteinase 3/PR3 Rabbit mAb Catalog No. A19748 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2275 Background
Enables enzyme binding activity; serine-type endopeptidase activity; and signaling receptor binding activity. Involved in several processes, including mature conventional dendritic cell differentiation; membrane protein ectodomain proteolysis; and neutrophil extravasation. Located in azurophil granule lumen; cytosol; and plasma membrane raft. Colocalizes with plasma membrane.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Proteinase 3/PR3 (P24158). Sequence MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHF Gene ID Swiss Prot Synonyms MBN; MBT; NP4; P29; PR3; ACPA; AGP7; NP-4; PR-3; CANCA; C-ANCA Calculated MW 28kDa Observed MW 28kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse liver Cellular location cytosol, extracellular exosome, extracellular region, extracellular space, plasma membrane, plasma membrane raft 
Western blot analysis of extracts of Mouse liver, using Proteinase 3/PR3 Rabbit mAb (A19748) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunofluorescence analysis of human spleen using Proteinase 3/PR3 Rabbit mAb (A19748) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Proteinase 3/PR3 (P24158). Isotype IgG