быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Rad21 Rabbit mAb (A19749)
- Описание
- Характеристики
-
Overview
Product name Rad21 Rabbit mAb Catalog No. A19749 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2276 Background
The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad21, a gene involved in the repair of DNA double-strand breaks, as well as in chromatid cohesion during mitosis. This protein is a nuclear phospho-protein, which becomes hyperphosphorylated in cell cycle M phase. The highly regulated association of this protein with mitotic chromatin specifically at the centromere region suggests its role in sister chromatid cohesion in mitotic cells.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 532-631 of human Rad21 (O60216). Sequence EKEDDEEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII Gene ID Swiss Prot Synonyms MGS; HR21; MCD1; NXP1; SCC1; CDLS4; hHR21; HRAD21 Calculated MW 72kDa Observed MW 130kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IP ChIP Recommended dilution - WB 1:500 - 1:2000
- ChIP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A549, NIH/3T3, C6 Cellular location Condensed nuclear chromosome, Cytosol, nuclear matrix, Nucleoplasm, Nucleus, Spindle pole 
Western blot analysis of extracts of various cell lines, using Rad21 Rabbit mAb (A19749) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Chromatin immunoprecipitation analysis of extracts of A-549 cells, using Rad21 antibody (A19749) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 532-631 of human Rad21 (O60216). Isotype IgG