быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SLC22A3/OCT3 Rabbit mAb (A19758)
- Описание
- Характеристики
-
Overview
Product name SLC22A3/OCT3 Rabbit mAb Catalog No. A19758 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2285 Background
Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 301-450 of human SLC22A3/OCT3 (O75751). Sequence GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFTSAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVACLVTAFLPEGIAWLRTTVATLGRLGITMAF Gene ID Swiss Prot Synonyms EMT; EMTH; OCT3 Calculated MW 61kDa Observed MW 61kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples PC-3, Mouse liver Cellular location Cell membrane, Apical cell membrane, Basolateral cell membrane, Mitochondrion membrane, Nucleus membrane, Nucleus outer membrane 
Western blot analysis of extracts of various cell lines, using SLC22A3/OCT3 Rabbit mAb (A19758) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded human liver cancer using SLC22A3/OCT3 Rabbit mAb (A19758) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using SLC22A3/OCT3 Rabbit mAb (A19758) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 301-450 of human SLC22A3/OCT3 (O75751). Isotype IgG