быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Syntrophin alpha 1 Rabbit mAb (A19759)
- Описание
- Характеристики
-
Overview
Product name Syntrophin alpha 1 Rabbit mAb Catalog No. A19759 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2286 Background
Syntrophins are cytoplasmic peripheral membrane scaffold proteins that are components of the dystrophin-associated protein complex. This gene is a member of the syntrophin gene family and encodes the most common syntrophin isoform found in cardiac tissues. The N-terminal PDZ domain of this syntrophin protein interacts with the C-terminus of the pore-forming alpha subunit (SCN5A) of the cardiac sodium channel Nav1.5. This protein also associates cardiac sodium channels with the nitric oxide synthase-PMCA4b (plasma membrane Ca-ATPase subtype 4b) complex in cardiomyocytes. This gene is a susceptibility locus for Long-QT syndrome (LQT) - an inherited disorder associated with sudden cardiac death from arrhythmia - and sudden infant death syndrome (SIDS). This protein also associates with dystrophin and dystrophin-related proteins at the neuromuscular junction and alters intracellular calcium ion levels in muscle tissue.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntrophin alpha 1 (Q13424). Sequence MASGRRAPRTGLLELRAGAGSGAGGERWQRVLLSLAEDVLTVSPADGDPGPEPGAPREQEPAQLNGAAEPGAGPPQLPEALLLQRRRVTVRKADAGGLGI Gene ID Swiss Prot Synonyms SNT1; LQT12; TACIP1; dJ1187J4.5 Calculated MW 54kDa Observed MW 59kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, HepG2, C6, Mouse kidney Cellular location cytoplasm, cytoskeleton, neuromuscular junction, postsynaptic membrane, synapse 
Western blot analysis of extracts of various cell lines, using Syntrophin alpha 1 Rabbit mAb (A19759) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of Mouse kidney, using Syntrophin alpha 1 Rabbit mAb (A19759) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntrophin alpha 1 (Q13424). Isotype IgG







