быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SRD5A2 Rabbit mAb (A19762)
- Описание
- Характеристики
-
Overview
Product name SRD5A2 Rabbit mAb Catalog No. A19762 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2287 Background
This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRD5A2 (P31213). Sequence MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLLGLFCVHYFHRTFVYSL Gene ID Swiss Prot Synonyms Calculated MW 28kDa Observed MW 28kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples PC-3, Mouse liver, Mouse testis, Mouse kidney, Rat testis, Rat kidney Cellular location cell body fiber 
Western blot analysis of extracts of various cell lines, using SRD5A2 Rabbit mAb (A19762) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunofluorescence analysis of mouse testis using SRD5A2 Rabbit mAb (A19762) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of rat testis using SRD5A2 Rabbit mAb (A19762) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRD5A2 (P31213). Isotype IgG