быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DBF4 Rabbit mAb (A19766)
- Описание
- Характеристики
-
Overview
Product name DBF4 Rabbit mAb Catalog No. A19766 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2293 Background
Predicted to enable protein serine/threonine kinase activator activity. Predicted to be involved in positive regulation of nuclear cell cycle DNA replication and regulation of cell cycle phase transition. Located in nuclear body.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DBF4 (Q9UBU7). Sequence MNSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQTLG Gene ID Swiss Prot Synonyms ASK; CHIF; DBF4A; ZDBF1 Calculated MW 77kDa Observed MW 77kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples PC-3, Jurkat Cellular location Nuclear body, Nucleoplasm, Nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using DBF4 Rabbit mAb (A19766) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DBF4 (Q9UBU7). Isotype IgG