быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
EB3/MAPRE3 Rabbit mAb (A19768)
- Описание
- Характеристики
-
Overview
Product name EB3/MAPRE3 Rabbit mAb Catalog No. A19768 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2305 Background
The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 182-281 of human EB3/MAPRE3 (Q9UPY8). Sequence CILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY Gene ID Swiss Prot Synonyms EB3; RP3; EBF3; EBF3-S Calculated MW 32kDa Observed MW 32kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse brain, Rat brain Cellular location Cytoplasm, Microtubule Cytoskeleton, Microtubule organizing center, Perinuclear region of cytoplasm, Spindle midzone 
Western blot analysis of extracts of various cell lines, using EB3/MAPRE3 Rabbit mAb (A19768) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of C6 cells using EB3/MAPRE3 Rabbit mAb (A19768) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using EB3/MAPRE3 Rabbit mAb (A19768) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using EB3/MAPRE3 Rabbit mAb (A19768) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 182-281 of human EB3/MAPRE3 (Q9UPY8). Isotype IgG