быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ERp29 Rabbit mAb (A19771)
- Описание
- Характеристики
-
Overview
Product name ERp29 Rabbit mAb Catalog No. A19771 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2295 Background
This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human ERp29 (P30040). Sequence MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNM Gene ID Swiss Prot Synonyms ERp28; ERp31; PDIA9; PDI-DB; C12orf8; HEL-S-107 Calculated MW 29kDa Observed MW 30kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, HepG2, A-431, NIH/3T3, Mouse brain, Mouse kidney, Rat lung, Rat spleen, Rat kidney Cellular location Cell surface, Endoplasmic Reticulum, Endoplasmic Reticulum lumen, Melanosome, Smooth endoplasmic reticulum 
Western blot analysis of extracts of various cell lines, using ERp29 Rabbit mAb (A19771) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded rat lung using ERp29 Rabbit mAb (A19771) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human placenta using ERp29 Rabbit mAb (A19771) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using ERp29 Rabbit mAb (A19771) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human ERp29 (P30040). Isotype IgG