быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Destrin Rabbit mAb (A19772)
- Описание
- Характеристики
-
Overview
Product name Destrin Rabbit mAb Catalog No. A19772 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2297 Background
The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Destrin (P60981). Sequence MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELM Gene ID Swiss Prot Synonyms ADF; ACTDP; HEL32; bA462D18.2 Calculated MW 19kDa Observed MW 19kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-549, MCF7, NIH/3T3, C6, Mouse lung, Mouse spleen, Rat lung, Rat spleen Cellular location Actin cytoskeleton, Cortical actin cytoskeleton, Cytoplasm, Extracellular exosome 
Western blot analysis of extracts of various cell lines, using Destrin Rabbit mAb (A19772) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Destrin (P60981). Isotype IgG