быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Pumilio 2 Rabbit mAb (A19783)
- Описание
- Характеристики
-
Overview
Product name Pumilio 2 Rabbit mAb Catalog No. A19783 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2308 Background
This gene encodes a protein that belongs to a family of RNA-binding proteins. The encoded protein functions as a translational repressor during embryonic development and cell differentiation. This protein is also thought to be a positive regulator of cell proliferation in adipose-derived stem cells. Alternate splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pumilio 2 (Q8TB72). Sequence MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAWGASHHSMSQPIMVQRRSGQGFHGNSEVNAILSPRSESGGLGVSMVEYVLS Gene ID Swiss Prot Synonyms PUMH2; PUML2 Calculated MW 114kDa Observed MW 110-125kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples PC-3, Mouse testis Cellular location Cytoplasm, Cytoplasmic stress granule, Cytosol, Nuclear membrane, Perinuclear region of cytoplasm 
Western blot analysis of extracts of Rat testis, using Pumilio 2 antibody (A19783) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts of various cell lines, using Pumilio 2 antibody (A19783) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pumilio 2 (Q8TB72). Isotype IgG