быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TC10/RHOQ Rabbit mAb (A19786)
- Описание
- Характеристики
-
Overview
Product name TC10/RHOQ Rabbit mAb Catalog No. A19786 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2309 Background
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The encoded protein is an important signalling protein for sarcomere assembly and has been shown to play a significant role in the exocytosis of the solute carrier family 2, facilitated glucose transporter member 4 and other proteins, possibly acting as the signal that turns on the membrane fusion machinery. Three related pseudogene have been identified on chromosomes 2 and 14.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-205 of human TC10/RHOQ (P17081). Sequence KEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT Gene ID Swiss Prot Synonyms ARHQ; TC10; TC10A; RASL7A; HEL-S-42 Calculated MW 23kDa Observed MW 23kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, A549, 22Rv1, Mouse heart, Rat heart Cellular location Extracellular exosome, Plasma membrane 
Western blot analysis of extracts of various cell lines, using TC10/RHOQ Rabbit mAb (A19786) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of Rat heart, using TC10/RHOQ Rabbit mAb (A19786) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded rat spleen using TC10/RHOQ Rabbit mAb (A19786) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-205 of human TC10/RHOQ (P17081). Isotype IgG