быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GOLPH4 Rabbit mAb (A19790)
- Описание
- Характеристики
-
Overview
Product name GOLPH4 Rabbit mAb Catalog No. A19790 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2315 Background
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GOLPH4 (O00461). Sequence MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYYELQTQLRKAEAVALKYQQHQESLSAQLQVVYEHRSRLEKSLQKERLEHKKAKEDFLVYKLEAQETL Gene ID Swiss Prot Synonyms P138; GIMPC; GOLPH4; GPP130 Calculated MW 82kDa Observed MW 130kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Hep G2 Cellular location Cis-Golgi network, Golgi apparatus, Golgi lumen, Transport vesicle 
Western blot analysis of extracts of various cell lines, using GOLPH4 antibody (A19790) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GOLPH4 (O00461). Isotype IgG