быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CDC40 Rabbit mAb (A19794)
- Описание
- Характеристики
-
Overview
Product name CDC40 Rabbit mAb Catalog No. A19794 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2321 Background
Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp17 protein, which functions in two different cellular processes: pre-mRNA splicing and cell cycle progression. It suggests that this protein may play a role in cell cycle progression.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDC40 (O60508). Sequence MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFR Gene ID Swiss Prot Synonyms EHB3; PCH15; PRP17; PRPF17 Calculated MW 66kDa Observed MW 75kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, HCT116, HepG2, Mouse lung, Mouse brain, Mouse spleen, Rat lung Cellular location nuclear speck, nucleoplasm 
Western blot analysis of extracts of various cell lines, using CDC40 Rabbit mAb (A19794) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat ovary using CDC40 Rabbit mAb (A19794) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using CDC40 Rabbit mAb (A19794) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse liver using CDC40 Rabbit mAb (A19794) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDC40 (O60508). Isotype IgG