быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Sec61A Rabbit mAb (A19795)
- Описание
- Характеристики
-
Overview
Product name Sec61A Rabbit mAb Catalog No. A19795 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2323 Background
The protein encoded by this gene has similarity to a mouse protein which suggests a role in the insertion of secretory and membrane polypeptides into the endoplasmic reticulum. It may also be required for the assembly of membrane and secretory proteins. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Sec61A (Q9H9S3). Sequence SMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLA Gene ID Swiss Prot Synonyms Sec61 alpha-2; SEC61A2 Calculated MW 52kDa Observed MW 52kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, SH-SY5Y, Mouse lung, Mouse testis, Mouse brain, Rat testis Cellular location Endoplasmic reticulum membrane 
Western blot analysis of extracts of various cell lines, using Sec61A Rabbit mAb (A19795) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Sec61A (Q9H9S3). Isotype IgG