быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Neurogenin 2 Rabbit mAb (A19800)
- Описание
- Характеристики
-
Overview
Product name Neurogenin 2 Rabbit mAb Catalog No. A19800 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2326 Background
This gene encodes a neural-specific basic helix-loop-helix (bHLH) transcription factor that can specify a neuronal fate on ectodermal cells and is expressed in neural progenitor cells within the developing central and peripheral nervous systems. The protein product of this gene also plays a role in the differentiation and survival of midbrain dopaminergic neurons.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Neurogenin 2 (Q9H2A3). Sequence GARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTK Gene ID Swiss Prot Synonyms NGN2; Atoh4; ngn-2; Math4A; bHLHa8 Calculated MW 29kDa Observed MW 29kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples C6, SH-SY5Y, Neuro-2a, Mouse brain, Rat brain Cellular location nucleus 
Western blot analysis of extracts of various cell lines, using Neurogenin 2 Rabbit mAb (A19800) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Neurogenin 2 (Q9H2A3). Isotype IgG