быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
STK33 Rabbit mAb (A19803)
- Описание
- Характеристики
-
Overview
Product name STK33 Rabbit mAb Catalog No. A19803 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2330 Background
Serine/threonine protein kinase (STK33) is a 524-residue kinase that belongs to the calcium/calmodulin-dependent family of kinases. STK33 exhibits differential expression in normal and malignant cancer tissue, including hepatocellular carcinoma. STK33 expression is required in the context of mutant KRAS, the most commonly mutated human oncogene, to maintain for cellular viability and proliferation. STK33 depletion via modulation of interacting proteins results in proteasome-mediated degradation of STK33 in human cancer cells, triggering apoptosis.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 399-514 of human STK33 (Q9BYT3). Sequence KEWKNNPESVEENTTEEKNKPSTEEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAEIKGEMEKTPVTPSQGTATKYPAKSGALSRTKKKL Gene ID Swiss Prot Synonyms STK33 Calculated MW 58kDa Observed MW 65kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples SH-SY5Y Cellular location cytoplasm, nucleus, perinuclear region of cytoplasm 
Western blot analysis of extracts of SH-SY5Y cells, using STK33 Rabbit mAb (A19803) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of NIH/3T3 cells using STK33 Rabbit mAb (A19803) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 399-514 of human STK33 (Q9BYT3). Isotype IgG