быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MAD3/MXD3 Rabbit mAb (A19807)
- Описание
- Характеристики
-
Overview
Product name MAD3/MXD3 Rabbit mAb Catalog No. A19807 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2333 Background
This gene encodes a member of the Myc superfamily of basic helix-loop-helix leucine zipper transcriptional regulators. The encoded protein forms a heterodimer with the cofactor MAX which binds specific E-box DNA motifs in the promoters of target genes and regulates their transcription. Disruption of the MAX-MXD3 complex is associated with uncontrolled cell proliferation and tumorigenesis. Transcript variants of this gene encoding different isoforms have been described.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-190 of human MAD3/MXD3 (Q9BW11). Sequence RRARMHIQKLEDQEQRARQLKERLRSKQQSLQRQLEQLRGLAGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGF Gene ID Swiss Prot Synonyms MYX; MAD3; BHLHC13 Calculated MW 23kDa Observed MW 24kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A549, DU 145, Jurkat Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using MAD3/MXD3 Rabbit mAb (A19807) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-190 of human MAD3/MXD3 (Q9BW11). Isotype IgG