быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
BCL2L12 Rabbit mAb (A19808)
- Описание
- Характеристики
-
Overview
Product name BCL2L12 Rabbit mAb Catalog No. A19808 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2334 Background
This gene encodes a member of a family of proteins containing a Bcl-2 homology domain 2 (BH2). The encoded protein is an anti-apoptotic factor that acts as an inhibitor of caspases 3 and 7 in the cytoplasm. In the nucleus, it binds to the p53 tumor suppressor protein, preventing its association with target genes. Overexpression of this gene has been detected in a number of different cancers. There is a pseudogene for this gene on chromosome 3. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human BCL2L12 (Q9HB09). Sequence GPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGL Gene ID Swiss Prot Synonyms Calculated MW 37kDa Observed MW 32kDa Applications
Reactivity Human Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:2000
- IP 1:100 - 1:500
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Immunohistochemistry Positive samples MCF7, PC-3 Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using BCL2L12 Rabbit mAb (A19808) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using BCL2L12 Rabbit mAb (A19808) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300 μg extracts of PC-3 cells using 3 μg BCL2L12 antibody (A19808). Western blot was performed from the immunoprecipitate using BCL2L12 antibody (A19808) at a dilution of 1:500.
-
Key applications Western blotting, Immunoprecipitation, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human BCL2L12 (Q9HB09). Isotype IgG