быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Syntaxin Rabbit mAb (A19813)
- Описание
- Характеристики
-
Overview
Product name Syntaxin Rabbit mAb Catalog No. A19813 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2339 Background
The protein encoded by this gene belongs to a family of proteins thought to play a role in the exocytosis of synaptic vesicles. Vesicle exocytosis releases vesicular contents and is important to various cellular functions. For instance, the secretion of transmitters from neurons plays an important role in synaptic transmission. After exocytosis, the membrane and proteins from the vesicle are retrieved from the plasma membrane through the process of endocytosis. Mutations in this gene have been identified as one cause of fever-associated epilepsy syndromes. A possible link between this gene and Parkinson's disease has also been suggested. [provided by RefSeq, Jan 2015]Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntaxin (P61266). Sequence MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIE Gene ID Swiss Prot Synonyms STX1A/STX1B/STX2/STX3 Calculated MW 33kDa Observed MW 35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Mouse spinal cord, Mouse brain, Rat spinal cord Cellular location axon, centrosome, cytoplasm, cytosol, microtubule organizing center, neuromuscular junction, nuclear lamina, nucleoplasm, nucleus, plasma membrane, presynaptic active zone membrane, SNARE complex, spindle, synaptic vesicle 
Western blot analysis of extracts of various cell lines, using Syntaxin antibody (A19813) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of Rat spinal cord, using Syntaxin antibody (A19813) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded rat brain using Syntaxin Rabbit mAb (A19813) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human brain using Syntaxin Rabbit mAb (A19813) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using Syntaxin Rabbit mAb (A19813) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of rat brain cells using Syntaxin Rabbit mAb (A19813) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse brain cells using Syntaxin Rabbit mAb (A19813) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntaxin (P61266). Isotype IgG