быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Histone H4 Rabbit mAb (A19815)
- Описание
- Характеристики
-
Overview
Product name Histone H4 Rabbit mAb Catalog No. A19815 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2340 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 24-103 of human Histone H4 (P62805). Sequence RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG Gene ID Swiss Prot Synonyms H4/p; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; HIST4H4 Calculated MW 11kDa Observed MW 11kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, NIH/3T3, C6 Cellular location extracellular exosome, extracellular region, nucleoplasm, nucleus 
Western blot analysis of extracts of various cell lines, using Histone H4 antibody (A19815) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat liver using Histone H4 Rabbit mAb (A19815) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using Histone H4 Rabbit mAb (A19815) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using Histone H4 Rabbit mAb (A19815) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic peptide corresponding to a sequence within amino acids 24-103 of human Histone H4 (P62805). Isotype IgG