быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GSC Rabbit mAb (A19817)
- Описание
- Характеристики
-
Overview
Product name GSC Rabbit mAb Catalog No. A19817 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2343 Background
This gene encodes a member of the bicoid subfamily of the paired (PRD) homeobox family of proteins. The encoded protein acts as a transcription factor and may be autoregulatory. A similar protein in mice plays a role in craniofacial and rib cage development during embryogenesis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GSC (P56915). Sequence MPASMFSIDNILAARPRCKDSVLPVAHSAAAPVVFPALHGDSLYGASGGASSDYGAFYPRPVAPGGAGLPAAVSGSRLGYNNYFYGQLHVQAAPVGPACC Gene ID Swiss Prot Synonyms SAMS Calculated MW 28kDa Observed MW 28kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-29, Hep G2, MCF7, Mouse brain Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using GSC Rabbit mAb (A19817) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GSC (P56915). Isotype IgG