быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
eIF2C3 Rabbit mAb (A19819)
- Описание
- Характеристики
-
Overview
Product name eIF2C3 Rabbit mAb Catalog No. A19819 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2345 Background
This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a tandem cluster of closely related family members including argonaute 4 and eukaryotic translation initiation factor 2C, 1. Two transcript variants encoding distinct isoforms have been identified for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 721-860 of human eIF2C3 (Q9H9G7). Sequence RTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHVSGQSNGRDPQALAKAVQIHQDTLRTMYFA Gene ID Swiss Prot Synonyms EIF2C3; Argonaute3; hAgo3 Calculated MW 97kDa Observed MW 97kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, C2C12, U-87MG, Mouse lung, Mouse brain, Rat lung Cellular location Condensed nuclear chromosome, Cytoplasm, Cytoplasmic ribonucleoprotein granule, Cytosol, Nucleoplasm, P-body 
Western blot analysis of extracts of various cell lines, using eIF2C3 Rabbit mAb (A19819) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human lung cancer using eIF2C3 Rabbit mAb (A19819) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 721-860 of human eIF2C3 (Q9H9G7). Isotype IgG