быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TAB3 Rabbit mAb (A19824)
- Описание
- Характеристики
-
Overview
Product name TAB3 Rabbit mAb Catalog No. A19824 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2350 Background
The product of this gene functions in the NF-kappaB signal transduction pathway. The encoded protein, and the similar and functionally redundant protein MAP3K7IP2/TAB2, forms a ternary complex with the protein kinase MAP3K7/TAK1 and either TRAF2 or TRAF6 in response to stimulation with the pro-inflammatory cytokines TNF or IL-1. Subsequent MAP3K7/TAK1 kinase activity triggers a signaling cascade leading to activation of the NF-kappaB transcription factor. The human genome contains a related pseudogene. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TAB3 (Q8N5C8). Sequence MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHSPDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVH Gene ID Swiss Prot Synonyms NAP1; MAP3K7IP3 Calculated MW 79kDa Observed MW 100kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, HepG2, Mouse liver Cellular location Cytosol, extracellular exosome, plasma membrane 
Western blot analysis of extracts of various cell lines, using TAB3 antibody (A19824) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Western blot analysis of extracts of mouse liver, using TAB3 antibody (A19824) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TAB3 (Q8N5C8). Isotype IgG