быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HSPA12A Rabbit mAb (A19825)
- Описание
- Характеристики
-
Overview
Product name HSPA12A Rabbit mAb Catalog No. A19825 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2351 Background
Predicted to enable ATP binding activity. Located in extracellular exosome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HSPA12A (O43301). Sequence SEQQSFLVVVAVDFGTTSSGYAYSFTKEPECIHVMRRWEGGDPGVSNQKTPTTILLTPERKFHSFGYAARDFYHDLDPNEAKQWLYLEKFKMKLHTTGDLT Gene ID Swiss Prot Synonyms HSPA12A Calculated MW 75kDa Observed MW 75kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse kidney, Rat kidney Cellular location cytoplasm, extracellular exosome, nucleus 
Western blot analysis of extracts of various cell lines, using HSPA12A Rabbit mAb (A19825) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HSPA12A (O43301). Isotype IgG