быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cytokeratin 6 (KRT6) Rabbit mAb (A19827)
- Описание
- Характеристики
-
Overview
Product name Cytokeratin 6 (KRT6) Rabbit mAb Catalog No. A19827 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2352 Background
Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. The type II keratins are clustered in a region of chromosome 12q13.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 465-564 of human Cytokeratin 6 (KRT6) (P48668). Sequence YRKLLEGEECRLNGEGVGQVNVSVVQSTISSGYGGASGVGSGLGLGGGSSYSYGSGLGIGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH Gene ID Swiss Prot Synonyms K6E; KRT6E; PPKNEFD Calculated MW 60kDa Observed MW 60kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 5637, A-431 Cellular location cytosol, extracellular exosome 
Western blot analysis of extracts of various cell lines, using Cytokeratin 6 (KRT6) Rabbit mAb (A19827) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human esophageal using Cytokeratin 6 (KRT6) (KRT6) Rabbit mAb (A19827) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 465-564 of human Cytokeratin 6 (KRT6) (P48668). Isotype IgG