быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CHX10 Rabbit mAb (A19828)
- Описание
- Характеристики
-
Overview
Product name CHX10 Rabbit mAb Catalog No. A19828 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2354 Background
This gene encodes a homeobox protein originally described as a retina-specific transcription factor. Mutations in this gene are associated with microphthalmia, cataracts and iris abnormalities.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 262-361 of human CHX10 (P58304). Sequence AAAESGRKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA Gene ID Swiss Prot Synonyms RET1; CHX10; HOX10; MCOP2; MCOPCB3 Calculated MW 39kDa Observed MW 43kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse spinal cord, Mouse brain, Rat spinal cord, Rat brain Cellular location Nucleus 
Western blot analysis of extracts of various lysates, using CHX10 Rabbit mAb (A19828) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 262-361 of human CHX10 (P58304). Isotype IgG