быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Lambda Light chain Rabbit mAb (A19831)
- Описание
- Характеристики
-
Overview
Product name Lambda Light chain Rabbit mAb Catalog No. A19831 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2357 Background
Predicted to be involved in immune response. Located in extracellular exosome.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human Lambda Light chain (P01701) Sequence MTCSPLLLTLLIHCTGSWAQSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSA Gene ID Swiss Prot Synonyms V1-19; IGLV151 Calculated MW 12kDa Observed MW 25kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse spleen, Rat spleen Cellular location Secreted, Cell membrane 
Western blot analysis of extracts of Mouse spleen, using Lambda Light chain antibody (A19831) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of Rat spleen, using Lambda Light chain antibody (A19831) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human cervix cancer using Lambda Light chain Rabbit mAb (A19831) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human tonsil using Lambda Light chain Rabbit mAb (A19831) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human Lambda Light chain (P01701) Isotype IgG