быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SATB2 Rabbit mAb (A19837)
- Описание
- Характеристики
-
Overview
Product name SATB2 Rabbit mAb Catalog No. A19837 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2363 Background
This gene encodes a DNA binding protein that specifically binds nuclear matrix attachment regions. The encoded protein is involved in transcription regulation and chromatin remodeling. Defects in this gene are associated with isolated cleft palate and cognitive disability. Alternate splicing results in multiple transcript variants that encode the same protein.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SATB2 (Q9UPW6). Sequence SMISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERENLSDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGLLSP Gene ID Swiss Prot Synonyms GLSS; DEL2Q32Q33; C2DELq32q33 Calculated MW 83kDa Observed MW 100kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IP Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples Rat brain Cellular location 
Western blot analysis of extracts of Rat brain, using SATB2 antibody (A19837) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry of paraffin-embedded human appendix using SATB2 Rabbit mAb (A19837) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon carcinoma using SATB2 Rabbit mAb (A19837) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon using SATB2 Rabbit mAb (A19837) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300 μg extracts of K-562 cells using 3 μg SATB2 antibody (A19837). Western blot was performed from the immunoprecipitate using SATB2 antibody (A19837) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SATB2 (Q9UPW6). KO Validated Validated Isotype IgG