быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SATB2 Rabbit mAb (A20220)
- Описание
- Характеристики
-
Overview
Product name SATB2 Rabbit mAb Catalog No. A20220 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC50977 Background
This gene encodes a DNA binding protein that specifically binds nuclear matrix attachment regions. The encoded protein is involved in transcription regulation and chromatin remodeling. Defects in this gene are associated with isolated cleft palate and cognitive disability. Alternate splicing results in multiple transcript variants that encode the same protein.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 634-733 of human SATB2 (NP_001165980.1). Sequence HDVGLYPDQEAIHTLSAQLDLPKHTIIKFFQNQRYHVKHHGKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENADKSKAAPAEIDQR Gene ID Swiss Prot Synonyms GLSS; DEL2Q32Q33; C2DELq32q33 Calculated MW 83kDa Observed MW 100kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:2000 - 1:10000
- IHC-P 1:1000 - 1:5000
- IF/ICC 1:50 - 1:200
- IP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples HCT116 Cellular location histone deacetylase complex, nuclear matrix, nucleoplasm 
Western blot analysis of extracts of various cell lines, using SATB2 antibody (A20220) at1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human colon using SATB2 Rabbit mAb (A20220) at dilution of 1:5000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of Mouse brain using SATB2 antibody (A20220) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 634-733 of human SATB2 (NP_001165980.1). KO Validated Validated Isotype IgG