быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Claudin18.2 Rabbit mAb (A20420)
- Описание
- Характеристики
-
Overview
Product name Claudin18.2 Rabbit mAb Catalog No. A20420 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC5062-02 Background
This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is upregulated in patients with ulcerative colitis and highly overexpressed in infiltrating ductal adenocarcinomas. PKC/MAPK/AP-1 (protein kinase C/mitogen-activated protein kinase/activator protein-1) dependent pathway regulates the expression of this gene in gastric cells. Alternatively spliced transcript variants encoding different isoforms have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLDN18.2 (P56856-2). Sequence MSTTTCQVVAFLLSILGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGFTECRPYFTILGLPAMLQAVRALMIVGIVLGAIGLLVSIFA Gene ID Swiss Prot Synonyms SFTA5; SFTPJ Calculated MW 28kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications IHC-P Recommended dilution - IHC-P 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Positive samples Cellular location Cell junction, Cell membrane, Multi-pass membrane protein, tight junction 
Immunohistochemistry of paraffin-embedded human stomach using CLDN18.2 Rabbit mAb (A20420) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human stomach using CLDN18.2 Rabbit mAb (A20420) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLDN18.2 (P56856-2). KO Validated Validated Isotype IgG