быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Rev-Erbα/NR1D1 Rabbit mAb (A20452)
- Описание
- Характеристики
-
Overview
Product name Rev-Erbα/NR1D1 Rabbit mAb Catalog No. A20452 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC50483 Background
This gene encodes a transcription factor that is a member of the nuclear receptor subfamily 1. The encoded protein is a ligand-sensitive transcription factor that negatively regulates the expression of core clock proteins. In particular this protein represses the circadian clock transcription factor aryl hydrocarbon receptor nuclear translocator-like protein 1 (ARNTL). This protein may also be involved in regulating genes that function in metabolic, inflammatory and cardiovascular processes.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 280-360 of human Rev-Erbα/NR1D1 (NP_068370.1). Sequence SPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ Gene ID Swiss Prot Synonyms EAR1; hRev; THRA1; THRAL; ear-1; REVERBA; REVERBalpha Calculated MW 67kDa Observed MW 75kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Hep G2, Mouse liver, Rat brain, Rat lung Cellular location cytoplasm, dendrite, dendritic spine, nuclear body, nucleoplasm, nucleus Customer validation IHC(Mus musculus)
WB(Mus musculus)
Western blot analysis of extracts of Mouse liver, using Rev-Erbα/NR1D1 antibody (A20452) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using Rev-Erbα/NR1D1 antibody (A20452) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts of HepG2, using Rev-Erbα/NR1D1 antibody (A20452) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 280-360 of human Rev-Erbα/NR1D1 (NP_068370.1). Isotype IgG