быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Somatostatin (SST) Rabbit mAb (A20617)
- Описание
- Характеристики
-
Overview
Product name Somatostatin (SST) Rabbit mAb Catalog No. A20617 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC50670 Background
The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human Somatostatin (SST) (NP_001039.1). Sequence TGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC Gene ID Swiss Prot Synonyms SMST; SST1 Calculated MW 13kDa Observed MW Refer to figures Applications
Reactivity Mouse, Rat Tested applications IHC-P Recommended dilution - IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Positive samples Cellular location Secreted Customer validation Immunostaining(Mus musculus)
Immunohistochemistry analysis of paraffin-embedded mouse brain using Somatostatin (SST) Rabbit mAb (A20617) at dilution of 1:200(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse stomach using Somatostatin (SST) Rabbit mAb (A20617) at dilution of 1:200(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat brain using Somatostatin (SST) Rabbit mAb (A20617) at dilution of 1:200(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat stomach using Somatostatin (SST) Rabbit mAb (A20617) at dilution of 1:200(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human Somatostatin (SST) (NP_001039.1). Isotype IgG