быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Folate Binding Protein(FBP) / FOLR1 Rabbit mAb (A20726)
- Описание
- Характеристики
-
Overview
Product name Folate Binding Protein(FBP) / FOLR1 Rabbit mAb Catalog No. A20726 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC50859 Background
The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. Mutations in this gene have been associated with neurodegeneration due to cerebral folate transport deficiency. Due to the presence of two promoters, multiple transcription start sites, and alternative splicing, multiple transcript variants encoding the same protein have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Folate Binding Protein(FBP) / FOLR1 (NP_000793.1). Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHF Gene ID Swiss Prot Synonyms FBP; FOLR; NCFTD; FRalpha Calculated MW 30kDa Observed MW 38kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Mouse kidney, Rat kidney Cellular location Apical cell membrane, Cell membrane, Cytoplasmic vesicle, Endosome, GPI-anchor, Lipid-anchor, Secreted, clathrin-coated vesicle Customer validation WB(Mus musculus, Homo sapiens)

Western blot analysis of extracts of HeLa cells, using Folate Binding Protein(FBP) / FOLR1 antibody (A20726) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using Folate Binding Protein(FBP) / FOLR1 antibody (A20726) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Folate Binding Protein(FBP) / FOLR1 (NP_000793.1). Isotype IgG







