быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
E-Cadherin Rabbit mAb (A20798)
- Описание
- Характеристики
-
Overview
Product name E-Cadherin Rabbit mAb Catalog No. A20798 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51012 Background
This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion protein is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer. Loss of function of this gene is thought to contribute to cancer progression by increasing proliferation, invasion, and/or metastasis. The ectodomain of this protein mediates bacterial adhesion to mammalian cells and the cytoplasmic domain is required for internalization. This gene is present in a gene cluster with other members of the cadherin family on chromosome 16.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human E-Cadherin (NP_004351.1). Sequence PVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPR Gene ID Swiss Prot Synonyms UVO; CDHE; ECAD; LCAM; Arc-1; BCDS1; CD324 Calculated MW 97kDa Observed MW 135kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:100 - 1:500
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HCT116, Mouse lung, Mouse liver, Rat kidney Cellular location Cell junction, Cell membrane, Endosome, Golgi apparatus, Single-pass type I membrane protein, trans-Golgi network Customer validation WB(Homo sapiens, Mus musculus, Rattus norvegicus)
IF(Mus musculus, Homo sapiens)
IF(Homo sapiens)
IHC(Mus musculus)
WB(Mus musculus)
IP(Homo sapiens)
IHC(Homo sapiens)
Western blot analysis of extracts of various cell lines, using E-Cadherin antibody (A20798) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts of Rat kidney, using E-Cadherin antibody (A20798) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human liver using E-Cadherin Rabbit mAb (A20798) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse Intestine using E-Cadherin Rabbit mAb (A20798) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of MCF7 and HeLa cells using E-Cadherin Rabbit mAb (A20798) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human E-Cadherin (NP_004351.1). Isotype IgG