быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LDL Receptor (LDLR) Rabbit mAb (A20808)
- Описание
- Характеристики
-
Overview
Product name LDL Receptor (LDLR) Rabbit mAb Catalog No. A20808 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51372 Background
The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. The encoded protein is normally bound at the cell membrane, where it binds low density lipoprotein/cholesterol and is taken into the cell. Lysosomes release the cholesterol, which is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia. Alternate splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 761-860 of human LDL Receptor (LDLR) (NP_000518.1). Sequence TVEIVTMSHQALGDVAGRGNEKKPSSVRALSIVLPIVLLVFLCLGVFLLWKNWRLKNINSINFDNPVYQKTTEDEVHICHNQDGYSYPSRQMVSLEDDVA Gene ID Swiss Prot Synonyms FH; FHC; FHCL1; LDLCQ2 Calculated MW 95kDa Observed MW 100-160kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples A-431, HepG2, RAW 264.7, Mouse liver, Rat liver Cellular location Cell membrane, Cell surface, Early endosome, Endomembrane system, Golgi apparatus, Late endosome, Lysosome, Membrane, Single-pass type I membrane protein, clathrin-coated pit 
Western blot analysis of extracts of various cell lines, using LDL Receptor (LDLR) antibody (A20808) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts of A-431 cells, using LDL Receptor (LDLR) antibody (A20808) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunofluorescence analysis of HepG2 using LDL Receptor (LDLR) Rabbit mAb (A20808) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 761-860 of human LDL Receptor (LDLR) (NP_000518.1). Isotype IgG