быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DNA-PKcs Rabbit mAb (A20837)
- Описание
- Характеристики
-
Overview
Product name DNA-PKcs Rabbit mAb Catalog No. A20837 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51265 Background
This gene encodes the catalytic subunit of the DNA-dependent protein kinase (DNA-PK). It functions with the Ku70/Ku80 heterodimer protein in DNA double strand break repair and recombination. The protein encoded is a member of the PI3/PI4-kinase family.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 3993-4128 of human DNA-PKcs (NP_008835.5). Sequence SDPGLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM Gene ID Swiss Prot Synonyms HYRC; p350; DNAPK; DNPK1; HYRC1; IMD26; XRCC7; DNAPKc; DNA-PKC; DNA-PKcs Calculated MW 469kDa Observed MW 469kDa Applications
Reactivity Human Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples MCF7, SH-SY5Y Cellular location Nucleus, nucleolus 
Western blot analysis of various lysates, using DNA-PKcs antibody (A20837) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using DNA-PKcs Rabbit mAb (A20837) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using DNA-PKcs Rabbit mAb (A20837) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of HeLa cells using DNA-PKcs Rabbit mAb (A20837, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 3993-4128 of human DNA-PKcs (NP_008835.5). Isotype IgG