быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Lactate Dehydrogenase C Rabbit mAb (A20866)
- Описание
- Характеристики
-
Overview
Product name Lactate Dehydrogenase C Rabbit mAb Catalog No. A20866 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2796 Background
Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lactate Dehydrogenase C (P07864). Sequence MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQ Gene ID Swiss Prot Synonyms CT32; LDH3; LDHX Calculated MW 36kDa Observed MW 36kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using Lactate Dehydrogenase C antibody (A20866) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lactate Dehydrogenase C (P07864). Isotype IgG