быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CRTC3 Rabbit mAb (A20867)
- Описание
- Характеристики
-
Overview
Product name CRTC3 Rabbit mAb Catalog No. A20867 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2798 Background
This gene is a member of the CREB regulated transcription coactivator gene family. This family regulates CREB-dependent gene transcription in a phosphorylation-independent manner and may be selective for cAMP-responsive genes. The protein encoded by this gene may induce mitochondrial biogenesis and attenuate catecholamine signaling in adipose tissue. A translocation event between this gene and Notch coactivator mastermind-like gene 2, which results in a fusion protein, has been reported in mucoepidermoid carcinomas. Alternative splicing results in multiple transcript variants that encode different protein isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 520-619 of human CRTC3 (Q6UUV7). Sequence VQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL Gene ID Swiss Prot Synonyms TORC3; TORC-3 Calculated MW 67kDa Observed MW 75kDa/78kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, PC-12, MCF7, NIH/3T3, Mouse brain Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using CRTC3 antibody (A20867) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using CRTC3 Rabbit mAb (A20867) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human tonsil using CRTC3 Rabbit mAb (A20867) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 520-619 of human CRTC3 (Q6UUV7). Isotype IgG