быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CLPX Rabbit mAb (A20871)
- Описание
- Характеристики
-
Overview
Product name CLPX Rabbit mAb Catalog No. A20871 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2812 Background
The protein encoded by this gene is part of a protease found in mitochondria. This protease is ATP-dependent and targets specific proteins for degradation. The protease consists of two heptameric rings of the CLPP catalytic subunit sandwiched between two hexameric rings of the chaperone subunit encoded by this gene. Targeted proteins are unwound by this protein and then passed on to the CLPP subunit for degradation. Two transcript variants, one protein-coding and the other non-protein coding, have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 534-633 of human CLPX (O76031). Sequence SMDKCELNVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEPGYIRAPTKESSEEEYDSGVEEEGWPRQADAANS Gene ID Swiss Prot Synonyms EPP2 Calculated MW 69kDa Observed MW 69kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, U-937, HeLa, Mouse liver, Rat liver Cellular location cytosol, mitochondrial endopeptidase Clp complex, mitochondrial inner membrane, mitochondrial matrix, mitochondrial nucleoid, mitochondrion, nucleoplasm 
Western blot analysis of extracts of various cell lines, using CLPX antibody (A20871) at1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 534-633 of human CLPX (O76031). Isotype IgG