быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Epsin 1 Rabbit mAb (A20872)
- Описание
- Характеристики
-
Overview
Product name Epsin 1 Rabbit mAb Catalog No. A20872 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2813 Background
This gene encodes a member of the epsin protein family. The encoded protein binds clathrin and is involved in the endocytosis of clathrin-coated vesicles. Loss of function of this gene is associated with reduced tumor growth and progression in certain cancer types.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Epsin 1 (NP_001123544.1). Sequence EPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRGSLAEAVGSPPPAATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKA Gene ID Swiss Prot Synonyms EPN1 Calculated MW 60kDa Observed MW 65kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, U-937, HeLa, Mouse liver, Rat liver Cellular location Clathrin-coated pit, Cytosol, Endosome, nucleus, Plasma membrane 
Western blot analysis of extracts of various cell lines, using Epsin 1 antibody (A20872) at1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Epsin 1 (NP_001123544.1). Isotype IgG