быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ENDOGL1 / ENGL Rabbit mAb (A20881)
- Описание
- Характеристики
-
Overview
Product name ENDOGL1 / ENGL Rabbit mAb Catalog No. A20881 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2827 Background
This gene encodes an endo/exonuclease with 5'-3' exonuclease activity. The encoded enzyme catalyzes the hydrolysis of ester linkages at the 5' end of a nucleic acid chain. This enzyme is localized to the mitochondria and may play a role in programmed cell death. Alternatively spliced transcript variants have been described. A pseudogene exists on chromosome 18.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 269-368 of human ENDOGL1 / ENGL (Q9Y2C4). Sequence LQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS Gene ID Swiss Prot Synonyms ENGL; ENGLA; ENGLB; ENGL-a; ENGL-b; ENDOGL1; ENDOGL2 Calculated MW 41kDa Observed MW 41kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HL-60, HUVEC, MCF7 Cellular location Mitochondrion inner membrane 
Western blot analysis of extracts of various cell lines, using ENDOGL1/ENGL antibody (A20881) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 269-368 of human ENDOGL1 / ENGL (Q9Y2C4). Isotype IgG