быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SLP2 Rabbit mAb (A20883)
- Описание
- Характеристики
-
Overview
Product name SLP2 Rabbit mAb Catalog No. A20883 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2830 Background
Enables GTPase binding activity and cardiolipin binding activity. Involved in several processes, including inorganic cation transmembrane transport; positive regulation of cardiolipin metabolic process; and positive regulation of mitochondrial DNA replication. Located in membrane raft; mitochondrial inner membrane; and mitochondrial intermembrane space. Is extrinsic component of plasma membrane. Colocalizes with several cellular components, including COP9 signalosome; T cell receptor complex; and immunological synapse.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 10-130 of human SLP2 (Q9UJZ1). Sequence GALLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILEPGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLA Gene ID Swiss Prot Synonyms SLP-2; HSPC108 Calculated MW 39kDa Observed MW 40kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:1000 - 1:5000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HepG2, A549, Jurkat, Mouse liver, Rat brain Cellular location Cell membrane, Membrane raft, Mitochondrion inner membrane, Mitochondrion intermembrane space, Peripheral membrane protein 
Western blot analysis of extracts of various cell lines, using SLP2 antibody (A20883) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of MCF7 using SLP2 antibody (A20883) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 10-130 of human SLP2 (Q9UJZ1). Isotype IgG