быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ARFRP1 / ARP Rabbit mAb (A20884)
- Описание
- Характеристики
-
Overview
Product name ARFRP1 / ARP Rabbit mAb Catalog No. A20884 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2831 Background
The protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golgi network and endosomes. Alternatively spliced transcript variants encoding different isoforms have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 102-201 of human ARFRP1 / ARP (Q13795). Sequence STDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT Gene ID Swiss Prot Synonyms ARP; Arp1; ARL18 Calculated MW 23kDa Observed MW 25kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HepG2, PC-3, HeLa, Mouse liver, Mouse heart, Rat lung Cellular location Golgi apparatus, trans-Golgi network 
Western blot analysis of extracts of various cell lines, using ARFRP1/ARP antibody (A20884) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts of various cell lines, using ARFRP1/ARP antibody (A20884) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Immunofluorescence analysis of Jurkat cells using ARFRP1 / ARP Rabbit mAb (A20884) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 102-201 of human ARFRP1 / ARP (Q13795). Isotype IgG