быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cystatin B Rabbit mAb (A20886)
- Описание
- Характеристики
-
Overview
Product name Cystatin B Rabbit mAb Catalog No. A20886 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2833 Background
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). One type of mutation responsible for EPM1 is the expansion in the promoter region of this gene of a CCCCGCCCCGCG repeat from 2-3 copies to 30-78 copies.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-98 of human Cystatin B (NP_000091.1). Sequence MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF Gene ID Swiss Prot Synonyms PME; ULD; CST6; EPM1; STFB; CPI-B; EPM1A Calculated MW 11kDa Observed MW 13kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-87MG, HL-60 (Low expression control), Mouse liver, Mouse kidney Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using Cystatin B antibody (A20886) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts of various cell lines, using Cystatin B antibody (A20886) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-98 of human Cystatin B (NP_000091.1). Isotype IgG







