быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cip4 Rabbit mAb (A20891)
- Описание
- Характеристики
-
Overview
Product name Cip4 Rabbit mAb Catalog No. A20891 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2844 Background
Enables identical protein binding activity. Predicted to be involved in actin cytoskeleton organization; endocytosis; and signal transduction. Located in nucleoplasm. Biomarker of Huntington's disease.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cip4 (Q15642). Sequence MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPAKDDPESKFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCL Gene ID Swiss Prot Synonyms STP; CIP4; HSTP; STOT; TRIP-10 Calculated MW 68kDa Observed MW 76kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Hep G2, Mouse skeletal muscle, Mouse heart Cellular location Cell membrane, Cell projection, Cytoplasm, Golgi apparatus, Lysosome, cell cortex, cytoskeleton, perinuclear region, phagocytic cup 
Western blot analysis of various lysates, using Cip4 Rabbit mAb (A20891) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cip4 (Q15642). Isotype IgG