быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CYB5R3 Rabbit mAb (A20892)
- Описание
- Характеристики
-
Overview
Product name CYB5R3 Rabbit mAb Catalog No. A20892 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2849 Background
This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. Alternate splicing results in multiple transcript variants. Mutations in this gene cause methemoglobinemias.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYB5R3 (P00387). Sequence MGAQLSTLGHMVLFPVWFLYSLLMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSD Gene ID Swiss Prot Synonyms B5R; DIA1 Calculated MW 34kDa Observed MW 35kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Hep G2, A-431, K-562, Rat liver, Rat testis Cellular location Cytoplasm, Cytoplasmic side, Endoplasmic reticulum membrane, Lipid-anchor, Mitochondrion outer membrane. Customer validation WB(Homo sapiens)

Western blot analysis of extracts of various lysates, using CYB5R3 antibody (A20892) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYB5R3 (P00387). Isotype IgG







