быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HDLBP Rabbit mAb (A20896)
- Описание
- Характеристики
-
Overview
Product name HDLBP Rabbit mAb Catalog No. A20896 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2855 Background
The protein encoded by this gene binds high density lipoprotein (HDL) and may function to regulate excess cholesterol levels in cells. The encoded protein also binds RNA and can induce heterochromatin formation.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDLBP (NP_976221.1). Sequence MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEKAACLESAQEPSGAWGNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQ Gene ID Swiss Prot Synonyms HBP; VGL; PRO2900 Calculated MW 141kDa Observed MW 150kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Hep G2, HeLa, 293T, Jurkat, NIH/3T3, Rat pancreas Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using HDLBP antibody (A20896) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts of Rat pancreas, using HDLBP antibody (A20896) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded mouse brain using HDLBP Rabbit mAb (A20896) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse pancreas using HDLBP Rabbit mAb (A20896) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDLBP (NP_976221.1). Isotype IgG