быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NAT1 Rabbit mAb (A20897)
- Описание
- Характеристики
-
Overview
Product name NAT1 Rabbit mAb Catalog No. A20897 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2858 Background
This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NAT1 (P18440). Sequence MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKK Gene ID Swiss Prot Synonyms AAC1; MNAT; NATI; NAT-1 Calculated MW 34kDa Observed MW 33kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, Jurkat, SH-SY5Y Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using NAT1 antibody (A20897) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunofluorescence analysis of HeLa cells using NAT1 Rabbit mAb (A20897) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HepG2 cells using NAT1 Rabbit mAb (A20897) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using NAT1 Rabbit mAb (A20897) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using NAT1 Rabbit mAb (A20897) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-3 cells using NAT1 Rabbit mAb (A20897) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NAT1 (P18440). Isotype IgG