быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DENN Rabbit mAb (A20898)
- Описание
- Характеристики
-
Overview
Product name DENN Rabbit mAb Catalog No. A20898 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2860 Background
Tumor necrosis factor alpha (TNF-alpha) is a signaling molecule that interacts with one of two receptors on cells targeted for apoptosis. The apoptotic signal is transduced inside these cells by cytoplasmic adaptor proteins. The protein encoded by this gene is a death domain-containing adaptor protein that interacts with the death domain of TNF-alpha receptor 1 to activate mitogen-activated protein kinase (MAPK) and propagate the apoptotic signal. It is membrane-bound and expressed at a higher level in neoplastic cells than in normal cells. Several transcript variants encoding different isoforms have been described for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1548-1647 of human DENN (Q8WXG6). Sequence VQDLKTGEGGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPVSS Gene ID Swiss Prot Synonyms DENN; IG20; DEEAH; RabGEF; NEDDISH; RAB3GEP Calculated MW 183kDa Observed MW 220kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, SH-SY5Y, Mouse testis, Rat brain Cellular location axon, cytoplasm, cytosol, plasma membrane 
Western blot analysis of extracts of various cell lines, using DENN antibody (A20898) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded mouse brain using DENN Rabbit mAb (A20898) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using DENN Rabbit mAb (A20898) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1548-1647 of human DENN (Q8WXG6). Isotype IgG