быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
BCKDK Rabbit mAb (A20909)
- Описание
- Характеристики
-
Overview
Product name BCKDK Rabbit mAb Catalog No. A20909 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2875 Background
The branched-chain alpha-ketoacid dehydrogenase complex (BCKD) is an important regulator of the valine, leucine, and isoleucine catabolic pathways. The protein encoded by this gene is found in the mitochondrion, where it phosphorylates and inactivates BCKD. Several transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BCKDK (O14874). Sequence MILASVLRSGPGGGLPLRPLLGPALALRARSTSATDTHHVEMARERSKTVTSFYNQSAIDAAAEKPSVRLTPTMMLYAGRSQDGSHLLKSARYLQQELPV Gene ID Swiss Prot Synonyms BDK; BCKDKD Calculated MW 46kDa Observed MW 46kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, HepG2, PC-12, Mouse pancreas Cellular location Mitochondrion, Mitochondrion matrix Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using BCKDK antibody (A20909) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BCKDK (O14874). Isotype IgG